PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G1043
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 265aa    MW: 30555.9 Da    PI: 5.182
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G1043genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.98.7e-12956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+ +Ed++l+ ++ ++G  +W+  +++ g+ R++k+ ++rw +yl
      Gh_A13G1043  9 KGTWSRDEDQKLIAYIVRYGIWNWNEMPKHAGLQRSGKSSRLRWMNYL 56
                     799*****************99************************97 PP

2Myb_DNA-binding50.45e-1662105146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T eE+e ++++ k lG++ W++Ia++++  Rt++++k++w++
      Gh_A13G1043  62 RGNFTREEEETIIRLQKILGNR-WSAIAARLP-QRTDNDIKNYWNS 105
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5009010.511456IPR017877Myb-like domain
SuperFamilySSF466892.47E-257103IPR009057Homeodomain-like
SMARTSM007172.5E-8858IPR001005SANT/Myb domain
PfamPF002495.7E-10956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-191063IPR009057Homeodomain-like
CDDcd001673.08E-71156No hitNo description
PROSITE profilePS5129424.51557111IPR017930Myb domain
SMARTSM007171.4E-1461109IPR001005SANT/Myb domain
PfamPF002492.7E-1462105IPR001005SANT/Myb domain
CDDcd001671.68E-1064107No hitNo description
Gene3DG3DSA:1.10.10.608.2E-2564111IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MVRQPYLKKG TWSRDEDQKL IAYIVRYGIW NWNEMPKHAG LQRSGKSSRL RWMNYLRPNI  60
RRGNFTREEE ETIIRLQKIL GNRWSAIAAR LPQRTDNDIK NYWNSRLKKR VIVESNNSAS  120
SPTETKSSVE ENSSAADLEN NNSASSPTET KSSVEENSSD ADSSMMLGIF LDSDTPGMHD  180
FAEIAADTTF FPSGSNLSVA VDDHYSMAMD NYLVSYWEIL SFLEQPQMIE GLDCEAMSQN  240
SQQWHSHHQQ YYDPLHDFWV SPLIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2751113108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461557.11e-166PREDICTED: transcription factor WER-like
TrEMBLA0A0D2SDZ81e-167A0A0D2SDZ8_G
STRINGGLYMA06G45547.12e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17382411
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.11e-48myb domain protein 74